Mats Moléns missförstånd

Publicerat i Folkvett nr 1/1998.

Dan Larhammar. Kreationisten Mats Molén letar efter sponsorer till sitt skapelsemuseum, där han bland annat undervisar barn om Jordens ursprung. Molén är också författare till boken Vårt ursprung?, där han anfört förment vetenskapliga invändningar mot evolutionen. Men boken är så full av klassiska och nya tankefel att den knappast går att ta på allvar.

Den första utgåvan av kreationisten Mats Moléns bok Vårt ursprung? kom 1988 och har hyllats i kreationistiska kretsar. Trots titeln behandlar boken huvudsakligen geologi, och endast ett och ett halvt kapitel ägnas åt evolutionen och människans ursprung. På dessa 63 sidor har Molén fått med många klassiska missförstånd av evolutionen och därtill fogat flera nya som grundar sig på misstolkningar av genetiska fynd.

Boken är så belamrad med felaktigheter och missförstånd att recensioner ter sig överflödiga, vilket säkert förklarar varför så få sådana publicerats. Men trots alla sakfel och vantolkningar har uppenbarligen de många tabellerna och vetenskapliga uttrycken givit boken ett bedrägligt vederhäftigt uttryck. Till och med journalister i dagspressen har lurats att tro att det finns en saklig grund för Moléns kritik av evolutionen. Det är således på sin plats att inför hans planer på en ny utgåva påpeka några av de grövsta felaktigheterna.

Molén använder sig liksom de flesta andra evolutionskritiker av beprövade knep som att presentera ofullständiga (selekterade) data eller att beskriva slutsatser som om de motsade evolutionen när de i själva verket överensstämmer med evolutionsläran och ibland t o m förutsagts av den. Ett annat trick är att beskylla evolutionister för att använda cirkelbevis när det i stället handlar om oberoende observationer som leder till samma slutsats. Här ges några exempel på de olika typerna av faktaförvrängning och vantolkning som förekommer i Moléns bok.

Klassiska missförstånd

1. Osannolik Boeing

Sannolikheten för hur liv har kunnat uppstå beräknades 1981 av astronomerna Hoyle och Wickramasinghe. De kom fram till att sannolikheten är lika liten som att en tornado som sveper genom ett skrotupplag skulle resultera i en flygfärdig Boeing 747. Denna vansinniga metafor spreds även i svenska kyrkans Lilla boken om kristen tro härom året. Den enda slutsats som denna liknelse leder till är att varken dess upphovsmän eller de som sprider den har förstått vad liv är. Livsprocesser har som kärnpunkt en självkopiering av de molekyler som bär den genetiska informationen, dvs DNA och RNA. De första molekylerna som började kopieras (vare sig de uppstod på jorden eller möjligtvis kom hit från rymden) kan ha varit mycket enkla. Processen växte sedan gradvis i komplexitet och de molekyler som kopierades effektivast konkurrerade ut de långsammare. Tornadon genom skrotupplaget är den rakt motsatta processen, hur något blir fixt och färdigt i ett enda steg, dvs snarast en analogi till en skapelse.

Eftersom vi ännu idag inte vet exakt vilka de första självkopierande molekylerna var, hur de uppstod och hur de började kopieras är det fullständigt omöjligt att göra sannolikhetsberäkningar. Dock finns flera olika teorier som beskriver hur detta kan ha gått till, och vi vet att självkopierande molekyler i provrör snabbt kan anrikas utifrån enkla blandningar.

2. Bombarderarbaggen

Tack vare kreationister är bombarderarbaggarna (Brachinus) numera vida berömda skalbaggar. Den egenskap som fascinerat kreationisterna är att skalbaggarna när de känner sig hotade kan spruta ut en giftig vätska mot sina fiender. Vätskan innehåller väteperoxid och hydrokinon, och enligt kreationister är blandningen av dessa så explosiv att evolutionen omöjligt kan ha lett fram till de enzymer, nerver och muskler som behövs för att vid hot spruta ut blandningen av substanserna. Molén stämmer in i kören och föreslår att systemet skapats fixt och färdigt av en skapare.

I själva verket finns både väteperoxid och hydrokinon var för sig, med nödvändiga enzymer, hos många olika insekter. Dessutom är blandningen av komponenterna inte alls explosiv som kreationsisterna påstår. Uppkomsten av kombinationen kan således mycket väl förklaras med evolutionära mekanismer.

3. Det absurda ögat

Ett klassiskt exempel på ett komplicerat system som evolutionsförnekare gärna upprepar är det mänskliga ögat. Självaste Darwin skrev att tanken på att ögat skulle uppstått genom ett naturligt urval kunde förefalla (min kursivering) absurd – men han gick vidare och visade hur det trots allt kunnat ske. Richard Dawkins har också beskrivit hur evolution med många gradvisa steg kan leda till komplicerade strukturer. Forskare i Lund, Dan Nilsson och Susanne Pelger, har dessutom räknat ut att avancerade ögon kan bildas mycket snabbt från enkla ljus-mottagare, faktiskt snabbare än 400.000 år, ett ögonblick i det evolutionära perspektivet. Ögon som bildskapande organ kan ha uppstått hela 40-60 gånger under evolutionen.

Nya rön visar nu hur detta kan ha gått till på molekylär nivå. Den molekyl som startar hela utvecklingen av ögon tycks vara densamma i vitt skilda typer av djur. Likaså är den molekyl som utgör slutprodukten, själva ljusmottagaren, också strukturellt lik t o m mellan bananflugor och människor. Detta tyder på att ögon som ljusregistrerande organ kanske uppstått endast en enda gång under evolutionen. Därefter har olika utvecklingslinjer oberoende av varandra genomgått en utveckling från dessa enkla ljusdetektorer till mer eller mindre avancerade bildskapande organ. I ljuset av de nyupptäckta molekylära likheterna blir det evolutionära sammanhanget alltmer uppenbart och vi börjar få insikt i de många delstegen i processen.

Nya missförstånd

Det nya i Moléns evolutionskritik är att han diskuterar molekylära data, dvs jämförelser av sekvenser för proteiner mellan olika arter av djur och andra organismer. Det är här hans mest katastrofala missförstånd uppenbaras, och det är säkert här misstolkningarna är som svårast att genomskåda för en lekman. Mycket av det som Molén skriver om molekylära jämförelser har tidigare framförts i boken Evolution: A Theory in Crisis av Michael Denton, utgiven 1985. Denton citeras flitigt i vissa evolutionskritiska kretsar och beskrivs ömsom som biolog, molekylärbiolog eller paleontolog. Dentons bok är såpass detaljerad att han får antas besitta viss kunskap i molekylärbiologi, men hans slutsatser är så hårresande ologiska att de måste betraktas som rena kortslutningarna. Förmodligen har Denton medvetet gjort dessa absurda tolkningar i förhoppningen att läsarna inte skall genomskåda dem utan i stället tacksamt tro att evolutionen är motbevisad. Molén har frivilligt eller ofrivilligt låtit sig luras av Denton och använder samma resonemang.

Molekylära jämförelser

Först en kort bakgrund till molekylära jämförelser: Proteinsekvenser är ett relativt nytt tillskott till evolutionära studier. De första proteinerna sekvensbestämdes i flera olika djurarter på sextiotalet, t ex insulin. Sedan dess har informationsmängden ökat explosionsartat och under det senaste året har den kompletta arvsmassan på flera miljoner bokstäver sekvensbestämts för flera arter av bakterier. Människans arvsmassa på tre miljarder bokstäver är en god bit på väg att klarläggas och beräknas vara färdig om fem år. Utifrån gensekvenser kan proteinsekvenser härledas med hjälp av den genetiska koden som likaledes dechiffrerades på sextiotalet. Bild 1 och tabell 1 visar en jämförelse av sekvenser för hormonet insulin från olika arter av ryggradsdjur. Exempelvis är sekvenserna mer lika bland däggdjur och bland fiskar än i en jämförelse mellan däggdjur och fiskar.

Proteinsekvenser var inte bara ett nytt sätt att göra evolutionära jämförelser, det var också ett överlägset sätt att beräkna avståndens storlek mellan arter. Dessutom kunde hypoteser läggas fram i sann poppersk anda och lätt testas genom att bestämma proteinsekvenser. Idag är protein- och gen-sekvenser den flitigast använda måttstocken för evolutionära avstånd och har gjort det möjligt att jämföra många enkla organismer vars yttre egenskaper är svåra att iaktta, t ex bakterier och amöbor. Klassificeringen av sådana organismer är idag huvudsakligen baserad på sekvensjämförelser.

De första sekvensjämförelserna visade att skillnader tycktes ansamlas med ganska konstant hastighet oavsett typ av organism. Detta fenomen döptes till ”den molekylära klockan”. Fyndet var överraskande eftersom de skillnader som förs vidare i evolutionen är de som uppstår i könsceller och sedan förs vidare till avkomman – alltså borde evolutionshastigheten korrelera med antalet generationer snarare än antalet år. Vi vet ännu inte varför hastigheten korrelerar bättre med tid än med antal generationer, men denna egenskap hos sekvenser gör det möjligt att räkna ut de evolutionära avstånden.

Redan från början stod klart att olika proteiner har olika snabba molekylära klockor. Vissa proteiner är nästan identiska mellan kor och ärter, och har således en långsam klocka. Andra skiljer kraftigt t o m mellan råttor och marsvin. Dessutom har den snabbt ökande informationsmängden visat att hastigheten ibland avviker i enskilda utvecklingslinjer. Exempelvis har marsvin en kraftigt avvikande sekvens för insulin jämfört med andra däggdjur (Bild 1). Ofta beror sådana snabba förändringar på specifika händelser, t ex att en extra genkopia uppstått eller att mängden protein som tillverkas från genen har ökat eller minskat. Det avvikande insulinet i marsvin (och dess närmaste släktningar) tycks korrelera med att nivån av insulin i blodet är mycket högre än i andra däggdjur. Råttan har nyligen fått en extrakopia av insulin (Bild 1).

             B-kedja                        A-kedja                Skillnader
Människa     FVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCN
Hund         -----------------------------A ---------------------   1
Gris         -----------------------------A ---------------------   1
Häst         -----------------------------A --------G------------   2
Marsvin      --SR-----N---T--S--QDD----I--D ---D----GT-TRH--QS---  18
Val          -----------------------------A -------A-T-----------   3
Råtta 1      --K-----P--------------------S -D-------------------   4
Råtta 2      --K-------------------------MS -D-------------------   4
Kyckling     AA------------------------S--A -------HNT-----------   7
Skallerorm   AP--R----------F-I------Y-S-RS -------ENT-----------  12
Sköldpadda   AA------------------------S--A -------HNT-----------   7
Lax          AAA---------D--------K-------* -------RPF-NIFD-Q----  13+1
Marulk      VAPA---------D-------D-----N--* -------HRP-NIFD-Q----  13+2
Karp       NAGAP---------D-------PT----N--* -------HKP--IFE-Q----  14+3
Pigghaj      LPS-------------F---PK--Y-L--D ----H--HNT----D--G---Q 16+1
Bild 1. Jämförelse av insulinfrekvenser från olika ryggradsdjur. Människans sekvens används som mall. För de övriga sekvenserna anges endast skillnader gentemot människans sekvens. Stjärna anger att en position gått förlorad.

Under de senaste åren har man blivit varse att det finns skillnader i hastighet även inom ett och samma protein. I insulin förekommer exempelvis inga förändringar alls av aminosyran C (cystein) på de sex ställen den förekommer eftersom denna har mycket speciella egenskaper och om den byts ut förändras hela proteinets tredimensionella struktur. På andra positioner däremot är flera olika alternativ tänkbara (Bild 1).

Genom att helt enkelt räkna antalet skillnader mellan olika arter t o m för en så kort sekvens som insulin kan man få en grov uppfattning om de evolutionära sambanden. Alla ingående däggdjur i bild 1 har sinsemellan 0-6 skillnader, frånsett marsvinet. Det bästa sättet ett göra jämförelserna statistiskt säkra är att analysera sekvenser för ett stort antal olika proteiner. För de flesta andra proteiner uppför sig marsvinet som ett typiskt däggdjur, det är just insulin som avviker i marsvin.

djur
Tabell 1. Antal skillnader i insulinsekvenser mellan olika ryggradsdjur.

Fåglar-reptiler har 0-8 skillnader sinsemellan och ligger i intervallet 6-14 gentemot däggdjuren (frånsett marsvinet). Benfiskar har 7-10 skillnader sinsemellan men hela 13-22 gentemot de fyrfota djuren (däggdjur, fåglar och reptiler). Pigghajen har 13-20 skillnader mot alla de övriga. Visserligen har kycklingen färre skillnader mot t ex hund (6) än mot skallerorm (8), men det framgår av jämförelsen att detta beror på att ormen förutom de fyra positioner den delar med kyckling och sködpadda (men inte med däggdjur) fått flera unika positioner och således verkar ha haft en snabbare klocka.

Med ökande kunskap om proteinernas funktioner och med information från fler och fler arter ökar precisionen i de evolutionära beräkningarna. Om flera gener och proteiner är kända i en art kan dess släktskap med övriga arter beräknas säkrare. Jämförelser av sekvenser mellan olika arter ger uppfattning om det evolutionära avståndets storlek (i antal skillnader eller antal år), eller kan åtminstone användas för att rangordna släktskap, dvs avgöra om två arter är närmre släkt med varandra än med en tredje art. Oftast visar olika proteiner förbluffande samstämmighet.

Oberoende observationer

Molén ägnar flera sidor åt sekvensjämförelser, dock utan att först ange vilka observationer som skulle tala för eller emot evolution och vilka som skulle tala för eller emot en skapelse. Därför blir hans slutsatser godtyckliga – och ofta fullständigt ologiska. Ett exempel på detta är när Molén räknar skillnader i sekvensen för proteinet cytokrom c, som deltar i cellernas energiproduktion, och finner fler skillnader mellan människa och solros än mellan pirål och bananfluga. Han drar därav slutsatsen att sekvenserna ger ”matematiskt stöd för att djur- och växt-världen kan delas in i skapade slag”. Men samma observationer är precis lika förenliga med den evolutionära processen som säger att växter och djur skildes åt mycket tidigt i evolutionen och att djuren senare förgrenades från varandra och gav upphov till bananfluga, pirål och människa.

För att reda ut det evolutionära händelseförloppet måste man analysera processen steg för steg och inte enbart se till det totala antalet skillnader. När de fyra nämnda sekvenserna jämförs i alla parvis kombinationer finner man att människa och pirål är mest lika varandra, därefter kommer jämförelsen mellan människa/pirål och bananfluga, medan solrosen skiljer sig kraftigt från alla tre djuren. Människan och pirålen är alltså de närmaste släktingarna. Cytokrom c ger därmed samma resultat som jämförelser av anatomi och embryologi tidigare givit. Vi har således en helt ny typ av observation som oberoende av anatomiska jämförelser ger samma resultat. Molén tror att detta är ett cirkelbevis. I själva verket har evolutionen upptäckts en gång till med hjälp av sekvensjämförelser. Även om Darwin aldrig hade levat skulle vi ha förstått utifrån sekvensjämförelserna att jordklotets organismer är släkt med varandra genom en evolutionär process.

Molén jämför cytokrom c mellan ett antal djurarter och med bakterier. Han noterar att alla dessa djur har lika stora olikheter gentemot bakterier och påstår att detta är ett exempel på att det ”inte finns något mönster som stödjer evolutionsteorin”. I själva verket stämmer sekvensernas likheter perfekt med evolutionen: djuren har nämligen en gemensam föregångare som de alla utvecklats från, och denna föregångare i sin tur är en avlägsen släkting bakterier. Alltså bör vi förvänta oss ungefär samma antal skillnader hos alla djur gentemot bakterier.

I samma andetag säger Molén att ”människan liknar växter mer än något djur gör” eftersom människan har 35 skillnader gentemot solros medan t ex nejonöga har 46. Däremot ignorerar han att människan likväl är mer lik alla djur än vi är lika solrosen, och undanhåller därmed den allra viktigaste slutsaten av jämförelsen, nämligen att samtliga djur är närmre släkt med varandra än något djur är med solrosen, vilket är precis vad evolutionsläran hela tiden vetat. Moléns bok innehåller ett flertal liknande exempel på hur uppenbara slutsatser förbises eller medvetet undviks.

En annan fullständigt självklar slutsats som Molén drar av sekvenjämförelserna är att det ”…finns knappast några tecken på att någon organism är mer ursprunglig än någon annan”. Detta är naturligt eftersom sekvenserna är från nu levande arter, och alla har sedan deras förfäder skildes från varandra fortsatt att evolvera, dvs förändras. Evolutionen säger inte alls att någon nu levande organism skulle ha en mer ursprunglig proteinsekvens än någon annan. Trots det framför Molén sin slutsats som om den vore ett argument mot evolutionen. Vidare skriver han ”Man kan således inte ordna organismer i förfäder och avkomlingar” vilket också är självklart eftersom alla sekvenser är från nu levande organismer, alltså från avkomlingar. Det som sekvensjämförelserna åstadkommer är att uppskatta hur mycket (dvs hur länge) dessa avkomlingar divergerat från varandra och i vilken ordning de olika avkomlingarna divergerade från varandra.

Mellanformer

Ett vanligt argument som kreationister anför mot evolutionen är att s k mellanformer inte skulle kunnat existera, t ex ett djur med en mellanform mellan framben och vingar. Detta trots att många exempel verkligen finns på kroppsdelar och organ med dubbla funktioner. Molén försöker använda samma argument på proteinsekvenserna. Beträffande cytokrom c skriver han ”Det verkar dock mer troligt att sådana mellanformer inte kan fungera och därför heller aldrig kan ha funnits”. Likväl har han just analyserat sekvenser från en lång rad organismer som alla skiljer sig från varandra och som alla fungerar alldeles utmärkt i cellernas energiproduktion. Numera finns också många experimentella studier som visar dels att många positioner i proteiner kan bytas ut med bibehållen funktion, och dessutom att proteiner kan fungera mycket väl i andra organismer. Proteiner från möss kan fungera t o m i bananflugor.

Den mest groteska feltolkningen har Molén lånat från Michael Dentons ovan nämnda bok: ”Skillnaderna i sekvenserna visar (…) att alla organismer matematiskt kan delas in i grupper som skiljer sig klart från varandra utan att något djur eller någon slags växt är något slags mellanform mellan andra djur eller växter”. Molén hade alltså förväntat sig att sekvensjämförelserna skulle avslöja helt nya mellanformer. Det absurda i denna tankegång illustreras bäst med ett exempel: Antag att man är intresserad av det evolutionära släktskapet mellan äpple, päron och apelsin (Bild 2). Enligt evolutionsläran är äpplet och päronet närmare släkt med varandra än något av dem är med apelsinen. För att undersöka om detta verkligen stämmer analyserar man sekvenserna för ett visst protein från de tre frukterna. Därvid finner man att sekvenserna från äpple och päron är mer lika varandra än någon av dem är lik sekvensen från apelsin. Detta leder naturligtvis till slutsatsen att sekvenserna bekräftar de evolutionära släktskapen mellan de tre växterna. Men Molén drar i stället slutsatsen att sekvensjämförelserna har misslyckats med att upptäcka en ny mellanform!


Bild 2. Evolutionärt släktskap mellan äpple, päron och apelsin.

Råd till Mats Molén

Det är således hög tid för Molén att ge ut en ny utgåva av Vårt ursprung? och korrigera alla dessa – och många fler – vilseledande eller felaktiga påståenden. Om bara de vetenskapliga observationerna presenteras sakligt och fullständigt blir slutsatsen oundviklig: vi människor har ett gemensamt ursprung med alla andra levande varelser på planeten Jorden.

De genetiska exemplen på gemensamt ursprung är otaliga och överväldigande. Molén skulle kunna berätta om allt icke-kodande DNA vi människor delar med gorillor och schimpanser, dvs DNA som inte har någon funktion och som därför inte kan anses vara skapat för något visst ändamål. Det bara finns där och är oerhört likt (98%!) mellan schimpanser och människor vilket förklaras med självklar logik av gemensamt ursprung.

Dessutom finns gener som varierar så kraftigt människor emellan att en viss människas gen kan vara mer lik motsvarande gen från gorilla än från en annan människa. På samma sätt kan en annan människans genvariant vara mer lik genen från en schimpans än från den förstnämnda människan. Detta beror helt enkelt på att den ursprungspopulation av individer som gav upphov till människor, schimpanser och gorillor hade många olika genvarianter. Många av dessa bibehölls i var och en av de tre populationer som så småningom evolverade till de tre arterna. Genvarianterna är alltså äldre än arterna. I ljuset av evolutionen är detta inte det minsta märkligt, utan t o m förväntat för gener med många varianter.

Även om Darwin aldrig hade levt, även om paleontologin eller den jämförande antomin och embryologin aldrig hade funnits, så skulle den molekylära genetiken oundvikligen ha lett oss till slutsatsen att dagens levande organismer har ett gemensamt ursprung. Evolutionen är skriven på näsan på oss – eller rättare sagt i våra gener.

Dan Larhammar är professor i molekylär cellbiologi vid Uppsala universitet

Till sidan om Mats Molén – Årets förvillare 2001